What is Reverse Peptides?

Reverse Peptides is a company specializing in premium, research-based peptides. We provide high-quality peptides for scientific research, wellness optimization, and performance enhancement. Our products are designed to support various health goals, including improving energy, cognitive function, physical performance, and overall cellular health.

Are your products for human consumption?

No, all products sold by Reverse Peptides are intended for research and development purposes only. They are not for human or animal consumption and are not intended for therapeutic or diagnostic use.

How do I know which peptide is right for my needs?

We recommend researching the specific peptides that align with your goals. Whether you're interested in improving cognitive function, boosting metabolism, or enhancing athletic performance, our products are designed with precision. If you're unsure, our expert team can guide you on the best peptides for your research objectives.

Do you offer international shipping?

Currently, we offer domestic shipping within the United States. For international orders, please reach out to our customer support team to inquire about availability and shipping options.

How long does shipping take?

We offer fast, discreet shipping to ensure you receive your products as quickly as possible. Shipping times vary depending on your location, but most orders are processed within 1-2 business days. You will receive tracking information once your order has been shipped.

What are the payment options?

We accept a variety of payment methods, including credit cards and secure online payment systems. For more information, please visit our Payment Methods page during checkout.

Can I return or exchange my order?

Due to the nature of our products, we do not accept returns on any items. However, if there is an issue with your order or if you've received damaged goods, please contact our customer service team, and we'll assist you with a resolution.

Are the peptides safe to handle?

All of our peptides are research-grade chemicals intended for laboratory use. While they are manufactured to the highest standards, it's important to follow proper safety protocols when handling chemicals. Always refer to the product's specific handling instructions.

Are your products FDA-approved?

No, our products are not approved by the U.S. Food and Drug Administration (FDA) as they are for research purposes only. The statements made on our website have not been evaluated by the FDA.

How can I contact customer support?

You can reach our customer support team at: Phone: (631) 213-9712 Email: contact@reversepeptides.com We are happy to assist you with any inquiries or concerns.

Can I use Reverse Peptides products for personal health and wellness?

Our peptides are strictly intended for research purposes and should not be used for personal health or wellness applications. We recommend consulting with a healthcare professional if you are looking for therapeutic solutions.

Where can I learn more about peptide research?

We provide a variety of educational resources on our website, including detailed product descriptions, scientific information, and blog posts about the latest peptide research. You can also reach out to our team for more guidance on specific topics.

Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.

“GHK-cu 50mg” has been added to your cart. View cart

101% Original

Lowest Price

Free Shipping

LL-37 10mg

Name: LL-37 10mg - Reverse Peptides
SKU: SQ5418047
Price: 72.00 USD
Availability: InStock

$72

7 products sold in last 16 hours

Selling fast! Over 9 people have in their cart

25 people are viewing this right now

Estimated Delivery : Up to 4 business days
Free Shipping & Returns : On all orders over $200

Guaranteed Safe And Secure Checkout

Description
Reviews(0)

Description

LL-37 is a 37-amino-acid cationic peptide derived from the human cathelicidin precursor protein (hCAP-18). It exhibits broad-spectrum antimicrobial activity against bacteria, viruses, and fungi, while also modulating immune responses, promoting angiogenesis, and supporting wound healing in preclinical models.

Sequence & Composition

Amino Acid Sequence:
[LL-37, 37 aa]
Molecular Weight: ~4,493 Da
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃

Research & Applications

Antimicrobial Activity: Kills Gram-positive and Gram-negative pathogens, including antibiotic-resistant strains.
Immunomodulation: Regulates cytokine production, inhibits excessive inflammation, and promotes dendritic cell maturation.
Wound Healing: Enhances re-epithelialization and angiogenesis in skin injury models.
Antiviral & Antifungal Effects: Blocks viral entry mechanisms and disrupts fungal membranes.

Recommended Usage

In Vitro: 0.1–10 µM in cell culture or assay buffer.
In Vivo (Rodent Studies): 1–5 mg/kg via subcutaneous or intravenous injection, once daily or per protocol.
Solubility: Dissolve in sterile water or PBS; gentle warming (~37 °C) may aid dissolution.

Packaging & Storage

Packaging: 10 mg amber glass vial with desiccant.
Shelf Life: Up to 12 months unopened.
Storage Conditions: Store at 2–8 °C; protect from light and moisture; avoid repeated freeze–thaw cycles.