Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
101% Original
Lowest Price
Free Shipping

LL-37 10mg

$72

7 products sold in last 16 hours
Selling fast! Over 9 people have in their cart
23 people are viewing this right now
  • Check Mark Estimated Delivery : Up to 4 business days
  • Check Mark Free Shipping & Returns : On all orders over $200
  • Visa Card
  • MasterCard
  • American Express
  • Discover Card
  • PayPal
  • Apple Pay
Guaranteed Safe And Secure Checkout

Description

LL-37 is a 37-amino-acid cationic peptide derived from the human cathelicidin precursor protein (hCAP-18). It exhibits broad-spectrum antimicrobial activity against bacteria, viruses, and fungi, while also modulating immune responses, promoting angiogenesis, and supporting wound healing in preclinical models.


Sequence & Composition

  • Amino Acid Sequence:
    [LL-37, 37 aa]

  • Molecular Weight: ~4,493 Da

  • Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃


Research & Applications

  • Antimicrobial Activity: Kills Gram-positive and Gram-negative pathogens, including antibiotic-resistant strains.

  • Immunomodulation: Regulates cytokine production, inhibits excessive inflammation, and promotes dendritic cell maturation.

  • Wound Healing: Enhances re-epithelialization and angiogenesis in skin injury models.

  • Antiviral & Antifungal Effects: Blocks viral entry mechanisms and disrupts fungal membranes.


Recommended Usage

  • In Vitro: 0.1–10 µM in cell culture or assay buffer.

  • In Vivo (Rodent Studies): 1–5 mg/kg via subcutaneous or intravenous injection, once daily or per protocol.

  • Solubility: Dissolve in sterile water or PBS; gentle warming (~37 °C) may aid dissolution.


Packaging & Storage

  • Packaging: 10 mg amber glass vial with desiccant.

  • Shelf Life: Up to 12 months unopened.

  • Storage Conditions: Store at 2–8 °C; protect from light and moisture; avoid repeated freeze–thaw cycles.


For laboratory research use only. Not for human or veterinary consumption.


References

  1. Peptide Sciences: LL-37 5 mg (CAP-18) product page peptidesciences.com

  2. PubChem: LL-37 (CID 16198951) pubchem.ncbi.nlm.nih.gov

  3. InvivoGen: LL-37 overview invivogen.com

Reviews

There are no reviews yet.

Be the first to review “LL-37 10mg”

Your email address will not be published. Required fields are marked *