SKU: SQ5418047

LL-37 10mg

$72.00

ll-37
ll

Description

LL-37 is a 37-amino-acid cationic peptide derived from the human cathelicidin precursor protein (hCAP-18). It exhibits broad-spectrum antimicrobial activity against bacteria, viruses, and fungi, while also modulating immune responses, promoting angiogenesis, and supporting wound healing in preclinical models.

Sequence & Composition

  • Amino Acid Sequence:
    [LL-37, 37 aa]

  • Molecular Weight: ~4,493 Da

  • Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃

Research & Applications

  • Antimicrobial Activity: Kills Gram-positive and Gram-negative pathogens, including antibiotic-resistant strains.

  • Immunomodulation: Regulates cytokine production, inhibits excessive inflammation, and promotes dendritic cell maturation.

  • Wound Healing: Enhances re-epithelialization and angiogenesis in skin injury models.

  • Antiviral & Antifungal Effects: Blocks viral entry mechanisms and disrupts fungal membranes.

Recommended Usage

  • In Vitro: 0.1–10 µM in cell culture or assay buffer.

  • In Vivo (Rodent Studies): 1–5 mg/kg via subcutaneous or intravenous injection, once daily or per protocol.

  • Solubility: Dissolve in sterile water or PBS; gentle warming (~37 °C) may aid dissolution.

Packaging & Storage

  • Packaging: 10 mg amber glass vial with desiccant.

  • Shelf Life: Up to 12 months unopened.

  • Storage Conditions: Store at 2–8 °C; protect from light and moisture; avoid repeated freeze–thaw cycles.

For laboratory research use only. Not for human or veterinary consumption.

References

  1. Peptide Sciences: LL-37 5 mg (CAP-18) product page peptidesciences.com

  2. PubChem: LL-37 (CID 16198951) pubchem.ncbi.nlm.nih.gov

  3. InvivoGen: LL-37 overview invivogen.com

Reviews

There are no reviews yet.

Be the first to review “LL-37 10mg”

Your email address will not be published. Required fields are marked *

Related Products

Related products

FAQ

Research peptides are short chains of amino acids used in scientific and medical research. They are not approved for human consumption or therapeutic use but are studied for their potential biological effects.

Yes. Reverse Peptides offers 99% purity, third-party tested, and USA-made peptides. Our products are backed by quality assurance and a loyal base of researchers

Most peptides should be stored in a cool, dry place. Lyophilized powders are typically stable at room temperature but should be refrigerated for long-term storage. Always refer to the product label.

We accept major credit/debit cards and secure online payment options. All transactions are encrypted and secure.

No. Since our peptides are sold strictly for laboratory research purposes, no prescription is required. However, buyers must be qualified researchers or institutions.