Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
“Melanotan 2 (MT2) 10mg” has been added to your cart. View cart
Description GHK-Cu is a copper-binding tripeptide used in research and formulation R&D to support skin regeneration, stimulate collagen and elastin synthesis, accelerate wound-healing processes, and promote hair-follicle activity. Supplied as a high-purity lyophilized powder for laboratory and cosmetic R&D applications. Product highlights (research context) Stimulates fibroblast activity and extracellular matrix remodeling (collagen & elastin). Supports wound-healing…
Description Hexarelin is a potent synthetic growth hormone–releasing peptide (GHRP) that mimics the action of the endogenous ligand ghrelin to activate the growth hormone secretagogue receptor (GHSR). Compared to ghrelin, Hexarelin exhibits greater chemical stability and a longer half-life, making it a preferred tool for research on GH release, cardioprotection, and metabolic regulation. Chemical Makeup Sequence: His-D-2Nal-Ala-Trp-D-Phe-Lys-NH₂…
Description hGH Fragment 176–191 (also called AOD-9604 or tyr-hGH 176–191) is a synthetic 16-amino-acid fragment corresponding to the lipolytic C-terminus of human growth hormone, with a stabilizing tyrosine substitution at the N-terminus. It is investigated for its fat-burning and anti-obesity properties by potentially upregulating β₃-adrenergic receptor expression and promoting lipolysis without the full spectrum of GH-mediated…
Description Humanin is a small peptide encoded within mitochondrial 16S rRNA, renowned for its potent neuroprotective and cytoprotective effects. It defends cells against oxidative stress, apoptosis, and metabolic insults, making it a valuable tool in research on neurodegenerative diseases (Alzheimer’s, Parkinson’s), cardiovascular protection, and cellular stress responses. Sequence & Composition Amino Acid Sequence: Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Lys-Leu-Leu-Leu-Thr-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala Molecular Weight: ~2,687…
Description Ipamorelin is a synthetic pentapeptide agonist of the ghrelin receptor (GHS-R1a), designed to stimulate the release of growth hormone without affecting other pituitary hormones. It offers high selectivity for GH secretion and a favorable safety profile, making it a valuable tool in research on endocrine regulation, metabolic studies, and body composition models. Sequence &…
Description KPV is a bioactive tripeptide fragment derived from the C-terminal sequence of alpha–melanocyte–stimulating hormone (α-MSH). It demonstrates potent anti-inflammatory and immunomodulatory effects by binding to melanocortin receptors and reducing pro-inflammatory cytokine release in various cell models. Sequence Amino Acid Sequence: Lys–Pro–Val Other Names: α-MSH (11–13); Lys-Pro-Val Peptide Research & Applications Anti-Inflammatory Activity: Reduces TNF-α, IL-1β, and IL-6…
KPV (4mg) is a synthetic tripeptide derived from the alpha-MSH hormone, known for its potent anti-inflammatory and immune-modulating properties. It is primarily studied for its potential to treat inflammatory conditions, including gut disorders like IBD, while promoting tissue healing with minimal side effects.
Description LL-37 is a 37-amino-acid cationic peptide derived from the human cathelicidin precursor protein (hCAP-18). It exhibits broad-spectrum antimicrobial activity against bacteria, viruses, and fungi, while also modulating immune responses, promoting angiogenesis, and supporting wound healing in preclinical models. Sequence & Composition Amino Acid Sequence:[LL-37, 37 aa] Molecular Weight: ~4,493 Da Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃ Research & Applications Antimicrobial Activity: Kills…
Description Melanotan 2 (MT2) is a synthetic melanocortin receptor agonist originally developed as an α-MSH analog to stimulate melanogenesis (skin pigmentation). It is also a centrally-acting compound that has been reported to increase sexual arousal/desire as an observed pharmacologic effect in animal and human studies. MT-II is commonly used as a research reagent to probe melanocortin…
Description MOTS-c is a 16-amino-acid peptide encoded within the mitochondrial 12S rRNA. It translocates to the nucleus under metabolic stress and regulates adaptive gene expression via AMPK activation. In research settings, MOTS-c is studied for its roles in enhancing skeletal muscle glucose uptake, improving insulin sensitivity, promoting mitochondrial–nuclear communication, and supporting longevity and exercise-mimetic pathways¹….
Description Nonapeptide-1 is a synthetic, biomimetic peptide used in cosmetic and preclinical research to reduce hyperpigmentation and even skin tone. It acts primarily as an antagonist of α-melanocyte-stimulating hormone (α-MSH) signaling in melanocytes and has been shown in laboratory studies to lower melanin synthesis by down-regulating key melanogenic pathways (MC1R, MITF, tyrosinase and related enzymes). Nonapeptide-1…
Description PE-22-28 is a shortened synthetic analog of the naturally occurring peptide spadin, designed to potently block the TREK-1 potassium channel. By antagonizing TREK-1, PE-22-28 promotes rapid neurogenesis, exhibits antidepressant-like effects within days, and supports research into mood regulation, stroke recovery, and neurodegenerative disease models. Sequence & Composition Amino Acid Sequence: Gly-Val-Ser-Trp-Gly-Leu-Arg (GVSWGLR) Molecular Formula: C₃₅H₅₅N₁₁O₉ Molecular…
Description Bremelanotide (PT-141) is a synthetic melanocortin receptor agonist that has been investigated for its ability to enhance sexual desire and arousal. In clinical research it produced statistically significant increases in sexual desire and reductions in distress related to low desire in premenopausal women; additional preclinical and clinical studies have explored its effects on male sexual…
Description PT21 is a synthetic, 21-amino-acid peptide designed to mimic proline-rich motifs found in intracellular signaling proteins. By engaging SH3 domains and adaptor proteins, PT21 is widely used in research to dissect protein–protein interactions, receptor internalization pathways, and downstream kinase activation. Its optimized sequence enhances solubility and cell-permeability for robust in vitro and ex vivo assays….
Description PTD-DBM is a synthetic, cell-penetrating peptide engineered to interfere with the interaction between CXXC5 and Dishevelled (Dvl), a negative regulator of the Wnt/β-catenin pathway. By blocking this protein–protein interaction, PTD-DBM re-activates Wnt signaling in skin and follicular cells — driving processes associated with hair-follicle activation, wound-induced follicle neogenesis, dermal regeneration, and extracellular matrix remodeling. In…
Description Selank is a synthetic heptapeptide analogue of the endogenous immunoregulatory peptide tuftsin, engineered for enhanced metabolic stability. It modulates cytokine balance (including IL-6), influences monoamine neurotransmitter levels, and upregulates BDNF, resulting in rapid anxiolytic and cognitive-enhancing effects. Widely used in research on anxiety disorders, memory, neuroprotection, and stress resilience, Selank offers a non-sedating alternative…
In order to provide you a personalized shopping experience, our site uses cookies. By continuing to use this site, you are agreeing to our cookie policy.