Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
101% Original
Lowest Price
Free Shipping

FOXO4-DRI 10mg

$49

9 products sold in last 17 hours
Selling fast! Over 20 people have in their cart
30 people are viewing this right now
  • Check Mark Estimated Delivery : Up to 4 business days
  • Check Mark Free Shipping & Returns : On all orders over $200
  • Visa Card
  • MasterCard
  • American Express
  • Discover Card
  • PayPal
  • Apple Pay
Guaranteed Safe And Secure Checkout

Description

FOXO4-DRI is a synthetic, retro-inverso peptide that selectively disrupts the interaction between transcription factor FOXO4 and p53, inducing apoptosis in senescent cells and restoring tissue homeostasis in aging models.1


Sequence & Chemical Properties

  • Sequence: D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
  • Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
  • Molecular Weight: 5,358.06 Da
  • CAS Number: 2460055-10-9

Research & Applications

  • Senolytic Activity: Induces targeted apoptosis of senescent cells by displacing p53 from FOXO4, improving tissue function and extending healthspan in murine models.1
  • Organ Function Restoration: Demonstrated reversal of age-related decline in kidney and muscle tissue following chemotoxic stress.1
  • Reproductive Health: Enhances spermatogenesis in aged mice through clearance of senescent Leydig cells.2

Recommended Usage

  • In Vitro: 5 – 20 µM in culture media for senescence studies.
  • In Vivo (Rodent): 5 – 10 mg/kg via intraperitoneal injection, per published protocols.1
  • Solubility: Soluble in sterile water or PBS; gentle warming (~37 °C) may improve dissolution.

Packaging & Storage

  • Packaging: 10 mg amber glass vial with desiccant.
  • Shelf Life: Up to 12 months unopened.
  • Storage Conditions: Store at −20 °C; protect from moisture and light; avoid repeated freeze–thaw cycles.

All products are sold strictly for laboratory and analytical research use only. Not for human or veterinary consumption.


References

  1. Marjolein P. Baar et al. Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging. Cell. 2017;169(1):132–147.e16. https://pubmed.ncbi.nlm.nih.gov/28340339/
  2. Li Y, Zhang C, Cheng H, et al. FOXO4-DRI improves spermatogenesis in aged mice through reducing senescence-associated secretory phenotype secretion from Leydig cells. Exp Gerontol. 2024;195:112522. https://www.novoprolabs.com/p/foxo4-dri-peptide-318716.html
  3. FOXO4-DRI product page. MedChemExpress. https://www.medchemexpress.com/foxo4-dri.html
  4. FOXO4-DRI (10 mg) | Peptide Sciences. https://www.peptidesciences.com/foxo4-dri-10mg-proxofim

Reviews

There are no reviews yet.

Be the first to review “FOXO4-DRI 10mg”

Your email address will not be published. Required fields are marked *