FOXO4-DRI 10mg
2 products sold in last 3 hours
Selling fast! Over 19 people have in their cart
30 people are viewing this right now
- Estimated Delivery : Up to 4 business days
- Free Shipping & Returns : On all orders over $200
Description
FOXO4-DRI is a synthetic, retro-inverso peptide that selectively disrupts the interaction between transcription factor FOXO4 and p53, inducing apoptosis in senescent cells and restoring tissue homeostasis in aging models.1
Sequence & Chemical Properties
- Sequence:Â D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
- Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
- Molecular Weight:Â 5,358.06 Da
- CAS Number:Â 2460055-10-9
Research & Applications
- Senolytic Activity:Â Induces targeted apoptosis of senescent cells by displacing p53 from FOXO4, improving tissue function and extending healthspan in murine models.1
- Organ Function Restoration:Â Demonstrated reversal of age-related decline in kidney and muscle tissue following chemotoxic stress.1
- Reproductive Health:Â Enhances spermatogenesis in aged mice through clearance of senescent Leydig cells.2
Recommended Usage
- In Vitro: 5 – 20 µM in culture media for senescence studies.
- In Vivo (Rodent): 5 – 10 mg/kg via intraperitoneal injection, per published protocols.1
- Solubility: Soluble in sterile water or PBS; gentle warming (~37 °C) may improve dissolution.
Packaging & Storage
- Packaging:Â 10 mg amber glass vial with desiccant.
- Shelf Life:Â Up to 12 months unopened.
- Storage Conditions: Store at −20 °C; protect from moisture and light; avoid repeated freeze–thaw cycles.
All products are sold strictly for laboratory and analytical research use only. Not for human or veterinary consumption.
References
- Marjolein P. Baar et al. Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging. Cell. 2017;169(1):132–147.e16. https://pubmed.ncbi.nlm.nih.gov/28340339/
- Li Y, Zhang C, Cheng H, et al. FOXO4-DRI improves spermatogenesis in aged mice through reducing senescence-associated secretory phenotype secretion from Leydig cells. Exp Gerontol. 2024;195:112522. https://www.novoprolabs.com/p/foxo4-dri-peptide-318716.html
- FOXO4-DRI product page. MedChemExpress. https://www.medchemexpress.com/foxo4-dri.html
- FOXO4-DRI (10 mg) | Peptide Sciences. https://www.peptidesciences.com/foxo4-dri-10mg-proxofim






PT21 5mg
Epitalon 10mg
Acetyl Hexapeptide (Argireline) 10mg

Reviews
There are no reviews yet.