Description
FOXO4-DRI is a synthetic, retro-inverso peptide that selectively disrupts the interaction between transcription factor FOXO4 and p53, inducing apoptosis in senescent cells and restoring tissue homeostasis in aging models.1
Sequence & Chemical Properties
- Sequence: D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG)
- Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄
- Molecular Weight: 5,358.06 Da
- CAS Number: 2460055-10-9
Research & Applications
- Senolytic Activity: Induces targeted apoptosis of senescent cells by displacing p53 from FOXO4, improving tissue function and extending healthspan in murine models.1
- Organ Function Restoration: Demonstrated reversal of age-related decline in kidney and muscle tissue following chemotoxic stress.1
- Reproductive Health: Enhances spermatogenesis in aged mice through clearance of senescent Leydig cells.2
Recommended Usage
- In Vitro: 5 – 20 µM in culture media for senescence studies.
- In Vivo (Rodent): 5 – 10 mg/kg via intraperitoneal injection, per published protocols.1
- Solubility: Soluble in sterile water or PBS; gentle warming (~37 °C) may improve dissolution.
Packaging & Storage
- Packaging: 10 mg amber glass vial with desiccant.
- Shelf Life: Up to 12 months unopened.
- Storage Conditions: Store at −20 °C; protect from moisture and light; avoid repeated freeze–thaw cycles.
All products are sold strictly for laboratory and analytical research use only. Not for human or veterinary consumption.
References
- Marjolein P. Baar et al. Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging. Cell. 2017;169(1):132–147.e16. https://pubmed.ncbi.nlm.nih.gov/28340339/
- Li Y, Zhang C, Cheng H, et al. FOXO4-DRI improves spermatogenesis in aged mice through reducing senescence-associated secretory phenotype secretion from Leydig cells. Exp Gerontol. 2024;195:112522. https://www.novoprolabs.com/p/foxo4-dri-peptide-318716.html
- FOXO4-DRI product page. MedChemExpress. https://www.medchemexpress.com/foxo4-dri.html
- FOXO4-DRI (10 mg) | Peptide Sciences. https://www.peptidesciences.com/foxo4-dri-10mg-proxofim
Related Products
FAQ
1. What are research peptides?
Research peptides are short chains of amino acids used in scientific and medical research. They are not approved for human consumption or therapeutic use but are studied for their potential biological effects.
2. Is Reverse Peptides a trusted source for buying peptides online?
Yes. Reverse Peptides offers 99% purity, third-party tested, and USA-made peptides. Our products are backed by quality assurance and a loyal base of researchers
3. How do I store research peptides after receiving them?
Most peptides should be stored in a cool, dry place. Lyophilized powders are typically stable at room temperature but should be refrigerated for long-term storage. Always refer to the product label.
4. What payment methods do you accept?
We accept major credit/debit cards and secure online payment options. All transactions are encrypted and secure.
5. Is a prescription required to purchase peptides from Reverse Peptides?
No. Since our peptides are sold strictly for laboratory research purposes, no prescription is required. However, buyers must be qualified researchers or institutions.
Reviews
There are no reviews yet.