Showing all 6 results
ARA-290 (8mg) is a synthetic peptide derived from erythropoietin, designed to promote tissue protection and reduce inflammation without stimulating red blood cell production. It is primarily researched for its potential neuroprotective, anti-inflammatory, and pain-modulating effects.
BPC-157 (5mg) is a synthetic peptide derived from a protective protein found in the stomach. It is widely researched for its regenerative properties, particularly in promoting healing of muscles, tendons, ligaments, and the gastrointestinal tract.
Description GHK-Cu is a copper-binding tripeptide used in research and formulation R&D to support skin regeneration, stimulate collagen and elastin synthesis, accelerate wound-healing processes, and promote hair-follicle activity. Supplied as a high-purity lyophilized powder for laboratory and cosmetic R&D applications. Product highlights (research context) Stimulates fibroblast activity and extracellular matrix remodeling (collagen & elastin). Supports wound-healing…
KPV (4mg) is a synthetic tripeptide derived from the alpha-MSH hormone, known for its potent anti-inflammatory and immune-modulating properties. It is primarily studied for its potential to treat inflammatory conditions, including gut disorders like IBD, while promoting tissue healing with minimal side effects.
Description LL-37 is a 37-amino-acid cationic peptide derived from the human cathelicidin precursor protein (hCAP-18). It exhibits broad-spectrum antimicrobial activity against bacteria, viruses, and fungi, while also modulating immune responses, promoting angiogenesis, and supporting wound healing in preclinical models. Sequence & Composition Amino Acid Sequence:[LL-37, 37 aa] Molecular Weight: ~4,493 Da Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃ Research & Applications Antimicrobial Activity: Kills…
TB-500 (5mg) is a synthetic version of Thymosin Beta-4, a naturally occurring peptide involved in tissue repair and cell regeneration. It is studied for its potential to accelerate wound healing, improve muscle recovery, and reduce inflammation, particularly in injuries involving tendons, ligaments, and muscle tissue.
End of content
End of content
In order to provide you a personalized shopping experience, our site uses cookies. By continuing to use this site, you are agreeing to our cookie policy.
Don't have an account yet? Sign up
