3cc syringe with needle
$3.20Durable, multipurpose 3cc syringes equipped with a standard needle for drawing up and administering medications. Suitable for a variety of medical uses.
Showing 1–16 of 20 results
Durable, multipurpose 3cc syringes equipped with a standard needle for drawing up and administering medications. Suitable for a variety of medical uses.
Description 5-AMINO is a synthetic amino acid analog designed to mimic the terminal 5-amino-1 moiety for studies in peptide folding and receptor interaction. It is commonly used in research on G-protein coupled receptor ligands and structure–activity relationship (SAR) assays. Chemical Properties Sequence/Structure: H₂N-(CH₂)₄-COOH Molecular Formula: C₅H₁₁NO₂ Molecular Weight: 117.15 Da Other Names: 5-Aminovaleric Acid; 5-Amino Caproic Acid Research &…
Acetyl Hexapeptide-8 (commonly marketed as Argireline) is a synthetic hexapeptide derived from a SNAP-25 fragment. Topically applied in cosmetic and formulation research, it is studied for reducing the appearance of dynamic wrinkles by modulating neurotransmitter release at the neuromuscular junction and supporting skin texture and elasticity. It is widely used in serums and topical R&D…
Description AHK is a bioactive tripeptide composed of alanine, histidine, and lysine. It serves as a versatile tool in research for probing receptor interactions and modulating cellular signaling pathways involved in neuroprotection and wound healing. Sequence Amino Acid Sequence: Ala–His–Lys Other Names: AHK Peptide; AH-K Tripeptide Research & Applications Neuroprotective Effects: Demonstrates protective activity in neuronal cell models…
Pre-moistened antiseptic wipes for disinfecting skin prior to injections. Individually sealed for single-use convenience and hygiene.
Sterile diluent commonly used for reconstituting peptides and medications.
Chonluten is a small, tissue-selective regulatory peptide composed of GluÐAspÐGly. In preclinical and cell-based studies it has shown activity consistent with modulation of inflammatory gene programs and antioxidant pathwaysÑparticularly in lung, skin, and mucosal tissues. For formulation R&D and mechanistic assays, Chonluten is used to explore wound-healing endpoints, cytokine modulation, and epithelial repair responses. Key…
Description Decapeptide-12 is a fully synthetic peptide composed of ten amino acids, engineered to target and inhibit tyrosinase—the key enzyme catalyzing the early steps of melanin synthesis in melanocytes. By reducing tyrosinase activity, Decapeptide-12 helps diminish hyperpigmentation, melasma, and age spots, making it a valuable tool in dermatological and cosmetic research settings. Chemical Makeup Molecular Formula: C₆₅H₉₀N₁₈O₁₇…
Description Epitalon is a synthetic tetrapeptide derived from the pineal gland peptide epithalamin. It has been shown to activate telomerase, promote telomere elongation, and exert antioxidant and geroprotective effects in both cell culture and animal models. Researchers use Epitalon to study cellular aging, genome stability, and longevity pathways. Sequence & Composition Amino Acid Sequence: Ala–Glu–Asp–Gly Molecular…
Description FOXO4-DRI is a synthetic, retro-inverso peptide that selectively disrupts the interaction between transcription factor FOXO4 and p53, inducing apoptosis in senescent cells and restoring tissue homeostasis in aging models.1 Sequence & Chemical Properties Sequence: D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG) Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄ Molecular Weight: 5,358.06 Da CAS Number: 2460055-10-9 Research & Applications Senolytic Activity: Induces targeted apoptosis of senescent cells by displacing p53…
Description Hexarelin is a potent synthetic growth hormone–releasing peptide (GHRP) that mimics the action of the endogenous ligand ghrelin to activate the growth hormone secretagogue receptor (GHSR). Compared to ghrelin, Hexarelin exhibits greater chemical stability and a longer half-life, making it a preferred tool for research on GH release, cardioprotection, and metabolic regulation. Chemical Makeup Sequence: His-D-2Nal-Ala-Trp-D-Phe-Lys-NH₂…
Description hGH Fragment 176–191 (also called AOD-9604 or tyr-hGH 176–191) is a synthetic 16-amino-acid fragment corresponding to the lipolytic C-terminus of human growth hormone, with a stabilizing tyrosine substitution at the N-terminus. It is investigated for its fat-burning and anti-obesity properties by potentially upregulating β₃-adrenergic receptor expression and promoting lipolysis without the full spectrum of GH-mediated…
Description Humanin is a small peptide encoded within mitochondrial 16S rRNA, renowned for its potent neuroprotective and cytoprotective effects. It defends cells against oxidative stress, apoptosis, and metabolic insults, making it a valuable tool in research on neurodegenerative diseases (Alzheimer’s, Parkinson’s), cardiovascular protection, and cellular stress responses. Sequence & Composition Amino Acid Sequence: Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Lys-Leu-Leu-Leu-Thr-Ser-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala Molecular Weight: ~2,687…
Description KPV is a bioactive tripeptide fragment derived from the C-terminal sequence of alpha–melanocyte–stimulating hormone (α-MSH). It demonstrates potent anti-inflammatory and immunomodulatory effects by binding to melanocortin receptors and reducing pro-inflammatory cytokine release in various cell models. Sequence Amino Acid Sequence: Lys–Pro–Val Other Names: α-MSH (11–13); Lys-Pro-Val Peptide Research & Applications Anti-Inflammatory Activity: Reduces TNF-α, IL-1β, and IL-6…
Description Nonapeptide-1 is a synthetic, biomimetic peptide used in cosmetic and preclinical research to reduce hyperpigmentation and even skin tone. It acts primarily as an antagonist of α-melanocyte-stimulating hormone (α-MSH) signaling in melanocytes and has been shown in laboratory studies to lower melanin synthesis by down-regulating key melanogenic pathways (MC1R, MITF, tyrosinase and related enzymes). Nonapeptide-1…
Description Bremelanotide (PT-141) is a synthetic melanocortin receptor agonist that has been investigated for its ability to enhance sexual desire and arousal. In clinical research it produced statistically significant increases in sexual desire and reductions in distress related to low desire in premenopausal women; additional preclinical and clinical studies have explored its effects on male sexual…
End of content
End of content
In order to provide you a personalized shopping experience, our site uses cookies. By continuing to use this site, you are agreeing to our cookie policy.
Don't have an account yet? Sign up
FOXO4-DRI 10mg
1 × $49
Alcohol Pads - Pack of 10
1 × $0.59