3cc syringe with needle
$3.20Durable, multipurpose 3cc syringes equipped with a standard needle for drawing up and administering medications. Suitable for a variety of medical uses.
Showing 1–16 of 43 results
Durable, multipurpose 3cc syringes equipped with a standard needle for drawing up and administering medications. Suitable for a variety of medical uses.
Description 5-AMINO is a synthetic amino acid analog designed to mimic the terminal 5-amino-1 moiety for studies in peptide folding and receptor interaction. It is commonly used in research on G-protein coupled receptor ligands and structure–activity relationship (SAR) assays. Chemical Properties Sequence/Structure: H₂N-(CH₂)₄-COOH Molecular Formula: C₅H₁₁NO₂ Molecular Weight: 117.15 Da Other Names: 5-Aminovaleric Acid; 5-Amino Caproic Acid Research &…
Acetyl Hexapeptide-8 (commonly marketed as Argireline) is a synthetic hexapeptide derived from a SNAP-25 fragment. Topically applied in cosmetic and formulation research, it is studied for reducing the appearance of dynamic wrinkles by modulating neurotransmitter release at the neuromuscular junction and supporting skin texture and elasticity. It is widely used in serums and topical R&D…
Description AHK is a bioactive tripeptide composed of alanine, histidine, and lysine. It serves as a versatile tool in research for probing receptor interactions and modulating cellular signaling pathways involved in neuroprotection and wound healing. Sequence Amino Acid Sequence: Ala–His–Lys Other Names: AHK Peptide; AH-K Tripeptide Research & Applications Neuroprotective Effects: Demonstrates protective activity in neuronal cell models…
Pre-moistened antiseptic wipes for disinfecting skin prior to injections. Individually sealed for single-use convenience and hygiene.
ARA-290 (8mg) is a synthetic peptide derived from erythropoietin, designed to promote tissue protection and reduce inflammation without stimulating red blood cell production. It is primarily researched for its potential neuroprotective, anti-inflammatory, and pain-modulating effects.
Sterile diluent commonly used for reconstituting peptides and medications.
BPC-157 (5mg) is a synthetic peptide derived from a protective protein found in the stomach. It is widely researched for its regenerative properties, particularly in promoting healing of muscles, tendons, ligaments, and the gastrointestinal tract.
Cerebrolysin is a neuropeptide-based compound composed of low-molecular-weight peptides and amino acids. It is widely researched for its potential to support cognitive function, enhance neuroprotection, and aid in the treatment of neurodegenerative conditions like AlzheimerÕs disease and stroke.
Chonluten is a small, tissue-selective regulatory peptide composed of GluÐAspÐGly. In preclinical and cell-based studies it has shown activity consistent with modulation of inflammatory gene programs and antioxidant pathwaysÑparticularly in lung, skin, and mucosal tissues. For formulation R&D and mechanistic assays, Chonluten is used to explore wound-healing endpoints, cytokine modulation, and epithelial repair responses. Key…
CJC-1295 (5mg) is a synthetic peptide that stimulates the release of growth hormone by acting as a Growth Hormone Releasing Hormone (GHRH) analog. It is studied for its potential to increase muscle mass, enhance recovery, improve sleep, and support fat loss through sustained growth hormone elevation.
CJC-1295 W/DAC is a synthetic peptide that stimulates the release of growth hormone by acting as a Growth Hormone Releasing Hormone (GHRH) analog. It is studied for its potential to increase muscle mass, enhance recovery, improve sleep, and support fat loss through sustained growth hormone elevation.
Description Decapeptide-12 is a fully synthetic peptide composed of ten amino acids, engineered to target and inhibit tyrosinase—the key enzyme catalyzing the early steps of melanin synthesis in melanocytes. By reducing tyrosinase activity, Decapeptide-12 helps diminish hyperpigmentation, melasma, and age spots, making it a valuable tool in dermatological and cosmetic research settings. Chemical Makeup Molecular Formula: C₆₅H₉₀N₁₈O₁₇…
Description Dihexa is a small, blood-brain-barrier-permeable oligopeptide derived from angiotensin IV and developed as a potent synaptogenic/neurotrophic agent. In preclinical studies it potentiates hepatocyte growth factor (HGF) activity at the c-Met receptor and promotes spinogenesis and synaptogenesis, producing robust pro-cognitive effects in rodent models of cognitive impairment. PubMedWikipedia Sequence & Chemical Data Chemical name (representative): N-hexanoic-Tyr-Ile-(6)-aminohexanamide (commonly…
Description Epitalon is a synthetic tetrapeptide derived from the pineal gland peptide epithalamin. It has been shown to activate telomerase, promote telomere elongation, and exert antioxidant and geroprotective effects in both cell culture and animal models. Researchers use Epitalon to study cellular aging, genome stability, and longevity pathways. Sequence & Composition Amino Acid Sequence: Ala–Glu–Asp–Gly Molecular…
Description FOXO4-DRI is a synthetic, retro-inverso peptide that selectively disrupts the interaction between transcription factor FOXO4 and p53, inducing apoptosis in senescent cells and restoring tissue homeostasis in aging models.1 Sequence & Chemical Properties Sequence: D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG) Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄ Molecular Weight: 5,358.06 Da CAS Number: 2460055-10-9 Research & Applications Senolytic Activity: Induces targeted apoptosis of senescent cells by displacing p53…
End of content
End of content
In order to provide you a personalized shopping experience, our site uses cookies. By continuing to use this site, you are agreeing to our cookie policy.
Don't have an account yet? Sign up
Bacteriostatic Water 30ml
1 × $5.20
Alcohol Pads - Pack of 10
1 × $0.59