Product Usage: This PRODUCT IS INTENDED AS A RESEARCH CHEMICAL ONLY. This designation allows the use of research chemicals strictly for in vitro testing and laboratory experimentation only. All product information available on this website is for educational purposes only. Bodily introduction of any kind into humans or animals is strictly forbidden by law. This product should only be handled by licensed, qualified professionals. This product is not a drug, food, or cosmetic and may not be misbranded, misused or mislabeled as a drug, food or cosmetic.
“Epitalon 10mg” has been added to your cart. View cart
Description AHK is a bioactive tripeptide composed of alanine, histidine, and lysine. It serves as a versatile tool in research for probing receptor interactions and modulating cellular signaling pathways involved in neuroprotection and wound healing. Sequence Amino Acid Sequence: Ala–His–Lys Other Names: AHK Peptide; AH-K Tripeptide Research & Applications Neuroprotective Effects: Demonstrates protective activity in neuronal cell models…
BPC-157 (5mg) is a synthetic peptide derived from a protective protein found in the stomach. It is widely researched for its regenerative properties, particularly in promoting healing of muscles, tendons, ligaments, and the gastrointestinal tract.
CJC-1295 W/DAC is a synthetic peptide that stimulates the release of growth hormone by acting as a Growth Hormone Releasing Hormone (GHRH) analog. It is studied for its potential to increase muscle mass, enhance recovery, improve sleep, and support fat loss through sustained growth hormone elevation.
Description Dihexa is a small, blood-brain-barrier-permeable oligopeptide derived from angiotensin IV and developed as a potent synaptogenic/neurotrophic agent. In preclinical studies it potentiates hepatocyte growth factor (HGF) activity at the c-Met receptor and promotes spinogenesis and synaptogenesis, producing robust pro-cognitive effects in rodent models of cognitive impairment. PubMedWikipedia Sequence & Chemical Data Chemical name (representative): N-hexanoic-Tyr-Ile-(6)-aminohexanamide (commonly…
Description Epitalon is a synthetic tetrapeptide derived from the pineal gland peptide epithalamin. It has been shown to activate telomerase, promote telomere elongation, and exert antioxidant and geroprotective effects in both cell culture and animal models. Researchers use Epitalon to study cellular aging, genome stability, and longevity pathways. Sequence & Composition Amino Acid Sequence: Ala–Glu–Asp–Gly Molecular…
Description FOXO4-DRI is a synthetic, retro-inverso peptide that selectively disrupts the interaction between transcription factor FOXO4 and p53, inducing apoptosis in senescent cells and restoring tissue homeostasis in aging models.1 Sequence & Chemical Properties Sequence: D-(LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG) Molecular Formula: C₂₂₈H₃₈₈N₈₆O₆₄ Molecular Weight: 5,358.06 Da CAS Number: 2460055-10-9 Research & Applications Senolytic Activity: Induces targeted apoptosis of senescent cells by displacing p53…
KPV (4mg) is a synthetic tripeptide derived from the alpha-MSH hormone, known for its potent anti-inflammatory and immune-modulating properties. It is primarily studied for its potential to treat inflammatory conditions, including gut disorders like IBD, while promoting tissue healing with minimal side effects.
Description Melanotan 2 (MT2) is a synthetic melanocortin receptor agonist originally developed as an α-MSH analog to stimulate melanogenesis (skin pigmentation). It is also a centrally-acting compound that has been reported to increase sexual arousal/desire as an observed pharmacologic effect in animal and human studies. MT-II is commonly used as a research reagent to probe melanocortin…
Description Bremelanotide (PT-141) is a synthetic melanocortin receptor agonist that has been investigated for its ability to enhance sexual desire and arousal. In clinical research it produced statistically significant increases in sexual desire and reductions in distress related to low desire in premenopausal women; additional preclinical and clinical studies have explored its effects on male sexual…
Description Selank is a synthetic heptapeptide analogue of the endogenous immunoregulatory peptide tuftsin, engineered for enhanced metabolic stability. It modulates cytokine balance (including IL-6), influences monoamine neurotransmitter levels, and upregulates BDNF, resulting in rapid anxiolytic and cognitive-enhancing effects. Widely used in research on anxiety disorders, memory, neuroprotection, and stress resilience, Selank offers a non-sedating alternative…
Description Semax is a synthetic peptide analogue of the ACTH(4–10) fragment, renowned for its neuroprotective, nootropic, and immunomodulatory properties. It is widely used in preclinical and clinical research to: Enhance cognitive function, memory retention, and learning Promote neuronal survival and recovery in ischemic and traumatic brain injury models Modulate gene expression involved in vasculogenesis and…
Tesamorelin (5mg) is a synthetic peptide that acts as a Growth Hormone-Releasing Hormone (GHRH) analog, stimulating the pituitary gland to naturally increase growth hormone production. It is primarily studied for its ability to reduce visceral fat, improve body composition, and support metabolic health, especially in HIV-associated lipodystrophy.
In order to provide you a personalized shopping experience, our site uses cookies. By continuing to use this site, you are agreeing to our cookie policy.